PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013621594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 352aa    MW: 39910.6 Da    PI: 5.9419
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013621594.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
   XP_013621594.1 14 KGAWTIEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding482.9e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
   XP_013621594.1  67 RGEFSSEEEQIIIMLHAARGNK-WSVIARHLP-RRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-23664IPR009057Homeodomain-like
PROSITE profilePS5129424.478965IPR017930Myb domain
SuperFamilySSF466897.1E-2911108IPR009057Homeodomain-like
SMARTSM007176.1E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001675.02E-101661No hitNo description
Gene3DG3DSA:1.10.10.605.0E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129419.47366116IPR017930Myb domain
SMARTSM007172.0E-1466114IPR001005SANT/Myb domain
PfamPF002491.5E-1367112IPR001005SANT/Myb domain
CDDcd001675.54E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MSRKRCCVGE GLKKGAWTIE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWTNY  60
LKPEIKRGEF SSEEEQIIIM LHAARGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLIEEG  120
IDPVTHKPLA SNTNPTVTTT QPENLHSLDA SSSDKRYSRS SSMPPMSLPL SSGFNPVSEI  180
ITPVQRGSLS CKKSIKKSNS TSRLLNKVAA KATTIKDILS ATTISYESFS NGFPEQTRNE  240
EDSSNALADF DPFPQSLLYT EHEVHATSDL DMDQGYDFSY FLETLGRDEH NTNVEYGHDI  300
LLMSDVSQEV SSISVDDQEN MIGNFEGWSN YLLDHDGLIN DTDYDFLEKQ II
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7026920.0AB702692.1 Brassica oleracea var. viridis mRNA for Myb domain protein 28-1 (BoMyb28-1), complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621594.10.0PREDICTED: transcription factor MYB28-like
SwissprotQ9SPG20.0MYB28_ARATH; Transcription factor MYB28
TrEMBLA0A0D3AY760.0A0A0D3AY76_BRAOL; Uncharacterized protein
TrEMBLL8B7Q60.0L8B7Q6_BRAOV; Myb transcription factor BoMyb28-1
STRINGBra029311.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61420.20.0myb domain protein 28